poker88 penipu-🎖️toto up togel|XOXE88.COM

Ilustrasipepaya.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-APAKAHAndasukamengonsumsipepaya?Pepayamerupakanbuahyangtelahlamaterkenalakanmanfaatsehatnya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Manfaatpepayayangpalingterkenalialahbisamembantumengatasimasalahsusahbuangairbesar.Andabisamengpoker88 penipuonsumsibuahyangsatuinibegitusajaataudalambentuksaladpepaya,pudingpepaya,danlainnya.BacaJuga:6ManfaatPepayaCampurMadudanJerukNipis,BikinIstriKewalahanPepayabisadikonsumsisiapasaja.NamuntahukahAnda,priayangrutinmengonsumsipepayaternyatamendapatkanbeberapakeuntunganyangluarbiasa.Berikutinipenjelasannya,sepertidilansirlamanGenpi.co.1.MeningkatkanKualitasCairanPriaPepayamerupakansalahsatubuahyangmemilikikandunganfolatyangtidakhanyabermanfaatbagipria.BacaJuga:4ManfaatPepayaMentahyangTidakTerdugaFolatmampumenjagakesehatandankualitascairanyangdiproduksi.PepayamengandungvitaminCbisamembantupriayangmemilikigangguankesuburanatauinfertilitas.

DewiPerssik.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-PedangdutDewiPerssikmengungkapfaktamengejutkansoalmantansuaminya,AnggaWijaya.PelantunHikayatCintainimengakusempatmenolakdiajakberhubunganintimolehAnggadalamwaktuyanglama.DewiPerssikmengatakanhalitulantarandirinyakecewadengansangmantanyangkerapmengambiluangtanpaizin.BacaJuga:PesanuntukAnggaWijaya,DewiPerssik:StopMengomongMacam-macamAkutidakmelayanisuamikukarenaakudongkol,kesal,kataDepe-sapaannyasaatdiacaraPagiPagiAmbyarTransTV.Diapunmengakuhanyabisamenangisdikamarmengetahuisuaminyakalaitumalahmelakukanhaltersebut.Padahal,kataDepe,diakerapmengingatkanAnggaWijayaagartidakmengambiluangistri.BacaJuga:BerceraidariDewiPerssik,AnggaWijayaJatuhMiskin?Akusindirdiabiarterbuka,tetapimalahketawa-ketawa,tuturDepelalumenangis.PemiliknamaasliDewiMuriaAgunginipunmenyayangkansikapdankelakuansangmantankalaitu.IlustrasiPasangan.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-PASANGANmanayangtidaksukabermaincinta.Bermaincintaharusrutindilakukanpasanganagarhubunganmerekamakinerat.Selamaini,priaselaluberusahamembuatistrimerekamudahklimakssaatbermaincinta.Namun,sebaiknyasebagaiseorangistri,Andajugaharusmencobamemuaskansuamidiranjangdanmembantudiamudahklimaks.BacaJuga:3PosisiBermainCintadiKamarMandiyangBikinPasanganKetagihanAdabeberapacarayangseorangistribisalakukanuntukmerangsangsuamidia,salahsatunyabermaindenganputingsusupriayangdiacintai.Kesalahpahamanyangpalingumumtentangputinglaki-lakiadalahbahwamerekatidaksesensitifputingperempuan.Inisamasekalitidakbenar.Bahkan,beberapapriamembutuhkanrangsanganputingsusuagarbisaklimakslebihcepatatauintens.BacaJuga:Suami,Ini4TandaIstriAndaPura-puraTelahMencapaiKlimaksSaatBermainCintaSatustuditahun2018menemukan52persenpriaberusia18hingga22tahunmenemukanrangsanganputingmembangkitkangairahseksual.Berikutpenjelasannya,sepertidikutiplamanPulse.ng.poker88 penipu

poker88 penipu-🎖️toto up togel|XOXE88.COM

BenderaTaiwan.Foto:Reutersjpnn.com,BEIJING-SeorangaktivisasalTaiwanditahanaparatkeamanandiChinabersamaandengankunjungansingkatKetuaDPRAmerikaSerikatNancyPelosidipulautersebut,menurutlaporanmediasetempat,Kamis(4/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});AktivisbernamaYangChihYuenituditahanpadaRabuolehBiroKeamananNegara(BSS)diWenzhou,ProvinsiZhejiang,atasdugaanmelakukanaktivitasseparatismedemikemerdekaanTaiwandanmengancamkeamanannasionalChina.Priaberusia32tahunasalKotaTaichung,Taiwan,itutelahlamamengampanyekankemerdekaanTaiwan,menurutpernyataanBSS.BacaJuga:KetuaDPRASNekatKunjungiTaiwan,ChinaGelarLatihanTembakdiLautBohaiBirointelijenChinaitumenuduhYangbekerjasamadenganpihaklainmendirikanorganisasiilegalPartaiNasionalTaiwan.OrganisasitersebutmendorongTaiwanmenjadinegaraberdaulatdanmandirisertabergabungdenganPerserikatanBangsa-Bangsa(PBB),kataBSS.BSSjugamendugaYangtelahmerencanakandanmelakukankegiatanseparatisme,melakukankejahatandenganmencobamemecahbelahbangsa,sertamenghasutoranglainuntukmelakukantindakanseparatisme.BacaJuga:ChinaTebarAncaman,WNIdiTaiwan:Alhamdulillah,AmanBangetTiongkokKecamKunjunganKetuaDPRAmerikaSerikatNancyPelosikeTaiwanSementaraitu,jurubicaraKementerianLuarNegeriChina(MFA)HuaChunyingmenegaskanbahwapemerintahannyaakanmengambiltindakankonkretterkaitkunjungansingkatPelosikeTaiwanyangdianggapmelanggarkedaulatandanintegritasteritorialChina.Segalaakibatyangtimbul(darikunjunganitu)akanditanggungolehpihakASdankelompokseparatiskemerdekaanTaiwan,katadiplomatperempuanyangkinimenjabatwakilmenluitu.(ant/dil/jpnn)SyaharDiantono.Foto:dokHumasPolrijpnn.com,JAKARTA-IrjenSyaharDiantonodiangkatKapolriJenderalListyoSigitPrabowomenjadiKadivPropamPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SyaharmerupakantemanseangkatanJenderalListyoSigitPrabowo.Diajugadikenalsebagaisosokyangtaatberibadah.SyaharmenggantikanIrjenFerdySamboyangkinimenjadisorotanataskasuspembunuhanNofriansyahYosuaHutabarataliasBrigadirJ.BacaJuga:KapolriDepakIrjenFerdySambo,OrangNomor2diBareskrimJadiKadivPropamSyaharmerupakanalumnusAkademiKepolisian(Akpol)1991.DiamerupakantemanangkatanKapolriJenderalListyoSigitPrabowo.SejumlahjabatanpernahdiembanolehpriakelahiranBlora,JawaTengahitu.AntaralainKapolrestaPasuruan,KapolresPasuruan,WadirReskrimsusPoldaJawaTimur.BacaJuga:SosokyangMengambilCCTVdiRumahDinasFerdySamboSudahDikantongi,DiaTernyataPada2012,SyaharmenjabatsebagaiKasubditVIDittipideksusBareskrimPolri.PriayangmudahsenyumitulalumendapatpromosisebagaiDirekturReskrimsusPoldaKepulauanRiaupada2014.HargaemashariininaiktajampadaakhirperdaganganKamis(JumatpagiWIB)karenaparapelakupasarmenunggulaporanpekerjaanAS.Ilustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariininaiktajampadaakhirperdaganganKamis(JumatpagiWIB).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});poker88 penipuHargaemasberbalikmenguatdarikerugianseharisebelumnyadipicuolehpelemahanUSD.KenaikanlogammuliakarenaparapelakupasarmenunggulaporanpekerjaanASuntukpetunjukarahlintasankebijakanFederalReserve(TheFed)selanjutnya.BacaJuga:HargaEmasPegadaian,Kamis4Agustus2022,UBSdanAntamKompakTurun!KontrakhargaemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,melonjakUSD30,5atau1,72persenmenjadiditutuppadaUSD1.806,90perounce.InvestasisafeheavenkembalibertenggerdiataslevelpsikologisUSD1.800setelahbeberapaharitersandungpenguatanUSD.HargaemasberjangkatergelincirUSD13,30atau0,74persenmenjadiUSD1.776,40padaRabu(3/8)setelahterdongkrakUSD2,0atau0,11persenmenjadiUSD1.789,70padaSelasa(3/8).BacaJuga:HargaEmasPegadaianHariIni,Senin1Agustus2022,Stabil!Analispasarmenyebuthargaemasberakhirpadapenutupantertinggisejak30Juni,naikdiatasangkakunciUSD1.800perounce,karenainvestorfokuspadakemungkinanekonomiAmerikaSerikattergelincirkedalamresesi.DepartemenTenagaKerjaASmelaporkanKamis(4/8)bahwaklaimpengangguranawalASmeningkat6.000menjadi260ribudalampekanyangberakhir30Juli.Pekanyangberakhirpada23Julimelihatpeningkatanpermintaanyangberkelanjutanuntuktunjangannegaramenjadi1,42juta,angkatertinggisejakawalApril.Ilustrasinyerikarenainfeksisalurankemih.Foto:Hellosehatjpnn.com-InfeksisalurankemihatauISKbisamenganggukenyamanandalamberhubunganbadan.Secaraumum,gejalanyaberupanyeriataupanasketikasedangbuangairkecil,nyeripadapanggul,danwarnaurineterlihatkeruh.Adapunpenyebabinfeksisalurankemihadalahinfeksibakteriyangmasukmelaluisalurankencing.Kondisiinilebihseringmenyerangwanita,karenauretrapadatubuhwanitalebihpendekketimbangpria.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?Selainitu,posisivaginaberadadekatdengankandungkemih.Halinimembuatbakterilebihmudahmasukdanmenginfeksi.Agardiwaktumendatanginfeksisalurankemihtaklagiterjadidanmengganggukenyamanan,berikutbeberapahalyangperludilakukan:1.MinumCukupAirPutihSelainmenjagatubuhtetapterhidrasidenganbaik,airputihjugamenjagasalurankemihtetapsehatdanberfungsioptimal.BacaJuga:JamakSalatKarenaSibukBekerja,BagaimanaHukumnya?Selainitu,airputihbisameningkatkansistemkekebalantubuh,sehinggabakterijahatpuntidakakanmudahmenyerangdanmenyebabkaninfeksi.2.BuangAirKecilSetelahBerhubunganSeksHalinibergunauntukmengeluarkanbakteriyangmenempelpadaorganintimsetelahberhubungan.KapolriJenderalListyoSigitPrabowomengungkapperkembanganterkinikasuspembunuhanBrigadirJdiBareskrimPolri,Kamis(4/8/2022)malam.Foto:Ricardo/JPNNjpnn.com,JAKARTA-PolitikusGerindraAriefPoyuonomenyatakanKapolriJenderalListyoSigitPrabowotidakakanmain-maindalammengusutpembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasditembakdirumahmantanKadivPropamPolriIrjenFerdySambopadaJumat,8Julilalu.AriefPoyuonomenilaiKapolriJenderaListyotidakmain-mainmengusutkematianBrigadirJIlustrasiFoto:DokumenJPNN.comBacaJuga:BharadaETersangka,RezaBeberAnalisisMatematikaKejahatanTerencanaTimkhususyangdibentukKapolriJenderalListyoSigitsudahmengumumkantersangkakasuspembunuhanitu,yakniBharadaE.AkusihdukungKapolridanyakinJenderalListyotidakmain-maindalammengungkapkasusini,ucapAriefPoyuonokepadaJPNNpadaJumat(5/8).EkswakilketuaumumPartaiGerindraitumenilailangkahKapolrisudahsesuaiarahanPresidenJokowiyangmemerintahkanusuttuntaskematianBrigadirJdanjanganadayangditutupi.BacaJuga:WahaiBharadaE,ManfaatkanKesempatanIni,LPSKSiapMelindungi!Terlebihlagi,kataArief,KapolriorangyangtegakluruskepadaJokowi,sehinggaJenderalListyoSigitpastimenjalankanperintahPresidenKetujuhRIitusebaik-baiknya.ApapunKapolripastimenjagamuruahnamaJokowidalamkasusini,ucapnya.

NelsonSimanjuntakmenanggapipernyataanIrjenFerdySamboyangmenyinggungsoaltindakanBrigadirJkepadaistridankeluargaeksKadivPropamPolriitu.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-NelsonSimanjuntakmenanggapipernyataanIrjenFerdySamboyangmenyinggungsoaltindakanBrigadirJkepadaistridankeluargaeksKadivPropamPolriitu.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});NelsonselakukuasahukumkeluargaBrigadirJmengatakanpernyataanIrjenFerdySambomenunjukkanbahwajenderalbintangduatersebutmenganggapBrigadirJbersalah.Masihadadibatindia(IrjenFerdySambo)bahwaanakitu(BrigadirJ)salah,kan,begitu,kataNelsonkepadaJPNN.com,Kamis(4/8)malam.BacaJuga:PriaIniBilangKapolriTidakMain-Main,FaktaKematianBrigadirJAkanTerungkapKendatidemikian,Nelsonmenambahkanpihakkeluargabakalterusmengawaldanmengikutiproseshukumkasustersebutyangmasihberjalan.Kamitunggulah,proseshukumprosesperadilankedepan,kamitidakdiamsampaidisitu,tetapihukumituharusberjalan,ujarNelson.Sebelumnya,IrjenFerdySambomemohonmaafkepadaPolriatasinsidenkematianBrigadirYosuaHutabaratatauBrigadirJdirumahdinasnya.BacaJuga:SoalKematianBrigadirJ,AriefPoyuono:KapolriPastiMenjagaMuruahJokowiJenderalbintangduatersebutmenyampaikanpermohonannyaitudidepanawakmedia,saattibadilobiBareskrimPolri,Kamis(4/8)sekitarpukul09.55WIB.IrjenFerdySambodatangkeBareskrimuntukdiperiksadalamkasuspembunuhanBrigadirJ.PedangdutDewiPerssikmenangisungkapalasanmenolakberhubunganintim.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PedangdutDewiPerssiktakbisamenahankesedihanharusberceraiuntukketigakalinya.Diamengakukecewahubungandenganmantansuaminya,AnggaWijayaberakhirtakbaik.Pasalnya,selamamenikah,sangmantanpunyakebiasaanmengambiluangDewiPerssiktanpaizin.BacaJuga:DewiPerssikSampaiMenolakDiajakBerhubunganIntimGegaraIniPelantunHikayatCintaini,bahkansudahmengingatkanagarAnggaWijayatidakmelakukanhaltersebut.Akusindirdiabiarterbuka,tetapimalahketawa-ketawa,ujarDewiPerssiksaatdiacaraPagiPagiAmbyarTransTVbaru-baruini.Depe-sapaanakrabDewiPerssik,mengakusempatmemintasangmantanuntukmenjagaperasaannya.BacaJuga:BerceraidariDewiPerssik,AnggaWijayaJatuhMiskin?Akusampai(bilang)Kamubisaenggaksihenggakdramapadaorangbanyak?,kataDepelantasmenangis.KelakuanburukAnggaitupunternyatamembuatDepeengganmelayaniAnggaWijayadiranjangsaatmerekamasihmenikah.GandaputraMalaysiaAaronChia/SohWooiYikgagalnaikpodiumtertinggiCommonwealthGames2022.Foto:Twitter/@Badminton_Asiajpnn.com,BIRMINGHAM-KutukanbagigandaputraMalaysia,AaronChia/SohWooiYikterusberlanjut.Keduanyakembaligagalnaikpodiumtertinggi,kaliinidiajangCommonwealthGames2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Aaron/Sohsecaramengejutkankeokdisemifinaldaripasangantuanrumah,BenLane/SeanVendy(Inggris).WakilNegeriJiranitutumbanglewatpertarunganrubbergamedenganskor21-18,17-21,4-21diNationalExhibitionCentre,Birmingham.BacaJuga:KlasemenLigaInggrisSetelahMUKeokdanManCityBerjayaHasiliniterbilangmengejutkankarenasecaraperingkatAaron/SohberadajauhdiatasBen/Sean.WakilMalaysiaitusaatiniberadadirankingenamdunia,sedangkanBen/Seanmasihtercecerdiposisike-19.Takcumaitu,Aaron/SohjugamenyandangunggulanpertamaCommonwealthGames2022.BacaJuga:EriktenHagPujiCristianoRonaldo,TetapiSebutAda1KekuranganKekelahaninimenambahpanjangcatatankelambagiAaron/Soh.Hinggasaatini,keduanyabelumsekalipunnaikpodiumtertinggidalamturnameninternasional.Beruntung,Aaron/SohbisasedikitterhiburkarenaberhasilmerebutmedaliperungguCommonwealthGames2022.

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat)mengomentarisoalstatusBrigadirRickysebagaitersangkapembunuhNofriansyahYosuaHutabarataliasBrigadirJ.Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BrigadirRickyRizalatauBrigadirRR,ajudanPutriCandrawathi,istriIrjenFerdySamboditetapkansebagaitersangkadanlangsungditahandiRutanBareskrimPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirRRdijeratPasal340KUHPtentangPembunuhanBerencanaterhadapkasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJdirumahdinasIrjenFerdySambo.(RRdisangkakan)denganPasal340subsiderPasal338junctoPasal55danPasal56KUHP,kataKetuaTimPenyidikTimsusBareskrimPolriBrigjenAndiRianDjajadisepertidilansirAntara,Minggu(7/8).BacaJuga:JenderalBintang2IniSebutFerdySamboDijagaKetat,Selama30HarikeDepan,PerintahSiapa?DirekturTindakPidanaUmumBareskrimPolriitupenahananterhadapBrigadirRRterhitungmulaiMinggu(7/8)kemarin.Sebelumnya,TimPenyidikTimsusBareskrimPolritelahmenetapkanBhayangkaraDuaRichardEliezirPudihangLumiuatauBharadaEsebagaitersangkadengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.PasaliniberbedadenganyangdisangkakankepadaBrigadirRR.BacaJuga:IniAlasanPolriAmankanFerdySambodiPatsusKorpsBrimob,OhTernyataKeduanyaditetapkansebagaitersangkaberdasarkanlaporanpolisiyangdilayangkankeluargaBrigadirJ,yakniterkaitdugaanpembunuhanberencanaPasal340KUHPjuncto338,juncto351ayat(3)juncto55dan56KUHP.AdapunpenerapanPasal55danPasal56terhadaptersangkaBhadaraEdanBrigadirRRdimungkinkanmasihadatersangkalainnyayangdidugaterlibatdalamkasusini.Ilustrasi-PasangansuamiistriFoto:Ricardo/JPNN.comjpnn.com-SeksologdrBoykeDianNugrahaSpOGmengakubanyakdidatangipasienpriaberusia30tahun,yangmengeluhsudahejakulasidini.Parapasientersebutmengakubingungkarenaalatvitalmerekasulitberdiridancepatmengeluarkancairan,padahalmasihmuda.AlumnusFakultasKedokteranUniversitasIndonesia(FKUI)inimengatakanejakulasidinidisebabkanmakananyangkerapdikonsumsi.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaMenurutdokterBoyke,banyakmengonsumsimakananinstanjugabisamenjadisalahsatupenyebabnya.Selainitu,Boykemenyarankanagarmerekamenerapkanpolahidupsehatdanmelatihcarabercinta.Kalaucowokyangsudahmatangdiabisamengaturkapanejakulasi.Durasinya,gerakannya,diabisaatur,tuturBoyke,dikanalWAWEntertainment.BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiKeutamaanPuasaAsyuraBersertaNiatnyaPriakelahiran14Desember1956inijugamengungkapkancaraagarbisamencapaiklimaksbercinta.Jadi,ketikamauberhubungananggapitumain-main,ituadalahkehidupanyangmenyenangkan.Pokoknyanikmatiprosesnya,ungkpdrBoyke.(chi/jpnn)PolisiberjagadirumahdinasIrjenFerdySambo,KompleksPolriDurenTigasaatprarekonstruksikasusbakutembakpolisiyangmenewaskanBrigadirJ,Jakarta,Sabtu(23/7/2022).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KolumniskondangDahlanIskantidakcumamenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MelaluitulisanberjudulMendungUdandikolomDisway,DahlanjugamengulasdramabarukasuspembunuhanBrigadirJ.MenurutDahlan,setelahIrjenSamboditahan,masihbanyakdramabaruyangakanterungkap,salahsatunyatelahdimulaiolehBharadaE,tersangkapembunuhanYosua.BacaJuga:DahlanIskanMeneleponMahfudMD,BeginikahNasibIrjenFerdySambo?HmmmBharadaEyangselamainidisebutmenembakBrigadirJsudahmenyangkalitu,demikiandikutipdariDiswayedisiSenin(8/8).TulisaninibertepatandengansebulantewasnyaBrigadirJdirumahdinasFerdySambo,kawasanDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.MenurutDahlandalamtulisanitu,BharadaEsudahmulaitidaksungkanuntuktidakmenjalankanskenariosutradara.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriDIapunmempertanyakanapakahistriIrjenFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.Kelihatannyaskenariopelecehanseksualiniakanruntuhjuga.SetidaknyabegitulahdoapacarBrigadirJ,VeraSimanjuntak,demikiandikutipdariDisway.MantanKadivPropamPolriIrjenFerdySamboditahandiMakoBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-KolumniskondangDahlanIskanmenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});IrjenFerdySambodianggapmelanggarprosedurdalampenanganantempatkejadianperkara(TKP)tewasnyaBrigadirJ,yaitudirumahdinasjenderalbintangduaitu.DalamtulisanDiswayberjudulMendungUdan,DahlanmenulismomentumklimakskelihatansudahdekatdenganditahannyasuamiPutriCandrawathiitu.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriYangsempatbikinbingungadalahsangkaannya:hanyamelanggarkodeetik.Bukanpidana.Bukankejahatan.Bukanpembunuhan,dikutipdariDiswayedisiSenin(8/8).TulisanitubertepatandengansebulankematianBrigadirJyangtewasdirumahdinasSambo,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.Dahlanmenilaikebingunganpublikberalasan.Sebab,sanksipelanggaranetikhanyasoalstatuskeanggotaan.BacaJuga:BrigadirRickyRizalDitahan,IstriFerdySamboUngkapCintaTulusdiPinggirJalanKalaupelanggaranetiknyasangatberat,keanggotaannyabakaldicabutsecarapermanenaliasdipecat.Dipecat,sepertidrTerawandalamhalVaksinNusantara.DiadipecatdarikeanggotaanIkatanDokterIndonesia(IDI),lanjuttulisanDahlan.

NoraAlexandramemamerkanfotomesrabersamasuaminya,Jerinxyangbarusajabebasdaripenjara.Foto:Instagram/ncdpapljpnn.com,JAKARTA-MusikusJerinxSIDmerasagagalmenjadisuamidansempatdepresi,karenaduakalimasukpenjaradisaatusiapernikahannyadenganNoraAlexandra,masihseumurjagung.Jerinxbersyukur,sangistritakmeninggalkannyameskibanyaktekananyangditerimaNora.Sebab,banyakfansJerinxyangmenyebutnyasebagaipembawasialbagipentolanSIDitu.Priabertatoitumenyebuttidakadapernikahanyangsempurna.Jikapunada,hanyadifilm-filmfiksi.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiPernikahanadalahperihalpenyatuan2egoagarbertemudisatugariskeselarasanyangharmonis.Terdengarsimpeltapiaslinyaruwetmintaampunkarenasejatinyaisikepalamanusiatidakadayangbenar-benar100%sama.Sebuahpernikahanakandiujiketikaiasedangmengalamimasalahdancobaan,tulisJerinxlewatakunInstagram,Sabtu(6/8).Selainitu,perbedaanusiadirinyadenganNorayangterpauthingga18tahun,takbanyakmembantusaatmerekaditerjangmasalah.Pernikahankamicobaannyasungguhnyata.Darisebelumdansesudahmenikahsudahditerjangmasalahdemimasalahyangcukupserius.Jarakusiayang18tahunjugatidakbanyakmembantuketikatertimpamasalah.Kamiberduaadalahapi.Sayaterlalulamaterlibatdiduniaaktivismeyangcenderungtoxicdankeras.Istrijugasejaklahirtumbuhdilingkunganyangkeras.Jadinyayasama-samakeras,tuturnya.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaSaatberadadisituasiyangserbatertekan,JerinxmengakuiNoraAlexandrasungguhkuatdansetialuarbiasa.SebabbarusepuluhbulandipenjarakarenakasusIDI,JerinxkembalimasukbuikarenakasusdenganAdamDeni.KabareskrimPolriKomjenAgusAndriantoFoto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KabareskrimPolriKomjenAgusAndriantomenyebutakanadatersangkabarudalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TersangkabaruiniakandiumumkanlangsungolehKapolriJenderalListyoSigitPrabowobersamatimkhusus(timsus).TunggupengumumanPakKapolridantimkhususbesok(Selasa),katadiaketikadikonfirmasi,Senin(8/8).BacaJuga:GegaraBrigadirRicky,KomnasHAMTakLangsungPercayadenganKeteranganAjudanFerdySamboNamun,salahsatuanggotatimsusitubelummaumemerincisoalsiapatersangkabaruyangakandiumumkantersebut.DiahanyameyakinikasuskematianBrigadirJdirumahdinasIrjenFerdySamboituakansegeratuntas.Insyaallahtuntas,katamantanKapoldaSumateraUtaraitu.BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimDalamkasusiniPolritelahmenetapkanduaorangtersangka,yakniBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEdengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.TersangkakeduaadalahBrigadirRickyRizalatauBrigadirRR,disangkadenganPasap340KUHP(pembunuhanberencana)junctoPasal338junctoPasal55danPasap56KUHP.

poker88 penipu-🎖️toto up togel|XOXE88.COM

PetugasSatreskrimPolrestaBanyumasmemeriksaseorangpriaberinisialTT(51)yangditangkapkarenamenjualistrinyauntukmelayaninafsusejumlahprialain.ANTARA/HO-PolrestaBanyumasjpnn.com,PURWOKERTO-TT(51)ditangkapSatuanReserseKriminalPolrestaBanyumas,PoldaJawaTengah.Diadidugamenjualistrinyamelayaninafsusejumlahpria.WargaKabupatenBanyumas,Jateng,ituditangkapdiYogyakarta1Agustus2022.BacaJuga:SuamidiSurabayaJualIstrikePriaHidungBelang,MotifnyaTernyataKasusiniterungkapsetelahistripelaku,I(35),melaporkanperbuatansuaminyakepadakamipadaMei2022,kataKepalaSatreskrimPolrestaBanyumasKompolAgusSupriadiSiswantodiKantorSatreskrim,Purwokerto,KabupatenBanyumas,Senin(8/8)siang.Diamengatakansetelahmenerimalaporanitu,pihaknyamelakukanpenyelidikandanmencarikeberadaanpelakuyangkabursetelahmengetahuiistrinyamelaporkanperbuatannyakepadapolisi.KompolAgusmenegaskanpelakuditangkappetugasSatreskrimPolrestaBanyumasdiYogyakartapada1Agustus2022.BacaJuga:DihajarSuami,NelliMengadukeRumahPakRTLaluMeninggal,IniPelakunyaMenurutdia,sejauhiniadatigapriayangdilayaniolehkorbanatasperintahdandibawahancamandaripelaku.Tigapriamerupakanorangdekatataurekandarisuamikorban.Penjara(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Utang-piutangdiperbolehkandalamIslamkarenatermasukakadtaawun(tolongmenolong),untukyangmembutuhkanbantuandanjugamerupakanakadtabarru(sosial),sebagaikepedulianmembantuorang-orangyangsedangdalamkesulitan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Lalubagaimanadenganhartahasilkorupsi,masihkahharusdikembalikankenegara,sementarapelakunyasudahdipenjara?Parapelakuusahayangmengakutelahmengalamipailit,tidaklahgugurbegitusaja.SecarahukumIslam,utangpadadasarnyamerupakanbagiandariamanahyangtetapwajibdikembalikankepadapihakkrediturketikatelahjatuhtempo.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiNabiMuhammadSAWbersabdamenunda-nundapelunasanutangolehseorangyangmampumelunasinyamerupakanbentukkezaliman(mathlual-ghaniyyidhulmun).Istilahlaindarikezalimaniniadalahmoralhazard.DalamtuntunanagamaIslam,seorangkreditur(pemilikpiutang)ketikamenghadapikasusadanyapihakdebitur(pemilikutang)dianjurkanagarmemberirelaksasihinggaseseorangmenjadimampu(QSAl-Baqarah[2]:182).BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiNamun,ketikamenghadapiadanyakasusmoralhazardberupaupayauntukmengulur-ulurwaktusehinggamerugikankrediturataunegara,makapihakpemerintahberwenangmelakukantadib(pendidikanmoral)terhadapmereka.Adabeberapacaramemberikantadibterhadapdebituratauobligoryangnakalsemacaini,antaralaindenganjalandipenjara(habsun),diambilhartanyasecarapaksa(disita)(bial-qahri),ataubahkandenganjalanditahanpenyaluranhartanya(hajr).KuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyamemerintahkanuntukmenembakBrigadirJ.JawabanitudisampaikannyadiBareskrimPolri,Senin(8/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-BhayangkaraDuaRichardEliezeraliasBharadaEmengakumenembakBrigadirNofryansahYosuaHutabarataliasBrigadirJatasperintahatasannya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenyangmenewaskanBrigadirYosuaituterjadidirumahdinasIrjenFerdySambo,KomplekDurenTiga,JakartaSelatanpadaJumat(8/7).Lantas,siapasosokatasanBharadaEyangmemerintahkanuntukmenembakaBrigadirJitu?BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraKuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyaitu.Deolipamengatakanhaltersebutmerupakankewenanganpenyidik.Itusudahmasukkesubstansimateriil,sudahbukankewenangansayamenjawab,tetapikewenangandaripenegakhukumyanglainyaitukepolisian,kataDeolipadiBareskrimPolri,Senin(8/8)malam.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Disisilain,DeolipaengganmengungkappengakuankliennyalebihdetailkarenaitusubstansimaterillperkarakasuskematianBrigadirJ.Salahsatukewenangandalampenyidikanyangsifatnyamateriiladalahkewenangandaripadapenyidikpolisi.Kalauformilkamibisa,ujarDeolipa.KetuaKomnasHAMAhmadTaufanDamanik.AristoSetiawan/jpnnjpnn.com,JAKARTAPUSAT-KetuaKomisiNasionalHakAsasiManusia(HAM)AhmadTaufanDamanikmengakutidakmudahpercayadenganketeranganaidedecamp(ajudandanasistenrumahtangga)mantanKadivPropamIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutTaufan,merekabisasajaberbohongsoalkejadianyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratpada8Juli2022lalu.Apakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ucapTaufandiKomnasHAM,JakartaPusat,Senin(8/8).BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimPria57tahunitupunmendesakkamerapengawasatauCCTVditempatkejadianperkarauntuksegeradibukakarenamenjadialatbuktiutama.MakanyasayadesakCCTVharusdibuka,alatkomunikasidibuka,karenakalaucumaketeranganorangdemiorang(tidakkuat),jelasnya.KetidakpercayaanTaufansemakindiperkuatlantaranBrigadirRickyRizalditetapkansebagaitersangka.HalinimembuktikanbahwaketeranganRickysaatdiperiksaKomnasHAMtidakbenar.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Saatdiperiksa,RickymengakudirinyabersembunyidibalikkulkassaatperistiwapenembakanBrigadirJterjadi.Namunolehpolisi,Rickyjustruditetapkansebagaitersangkadengansangkaanterlibatpembunuhanberencana.

TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.IlustrasiFoto/dok:Ricardo/JPNN.comjpnn.com,JAKARTA-TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KedatanganduapengacaraBharadaE,yakniDeolipaYumaradanMuhammadBurhanuddindalamrangkaberkoordinasidenganpenyidikmengenaikasuspembunuhanBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.PengacaraeksajudanIrjenFerdySamboitumendadaktibadiBareskrimPolripukul20.46WIB.Sebelumnya,merekamenjadwalkankunjungankeBareskrimpadaSelasa(9/8)besok.BacaJuga:BharadaEJadiTersangkadanDitahan,BagaimanaKondisiKeluarga?Kedatangankamitentunyakepentingan-kepentinganuntukmenanganiperkara-perkara,salahsatumenanganiperkaraialahdengancaraberkoordinasi,kataDeolipadiBareskrimPolri.DeolipamengakubanyakhalyangingindikoordinasikandenganpenyidikPolri.Salahsatunya,lanjutdia,terkaitjusticecollaborator(JC)BharadaEyangsudahdiajukankepadaLembagaPerlindunganSaksidanKorban(LPSK)pagitadi.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraSelainitu,lanjutdia,pertemuanmalaminidimungkinkanuntukmenambahBeritaAcaraPemeriksaan(BAP)yangsudahdisampaikanBharadaE.Namun,diamemastikantidakadapernyataankliennyayangberubahhariini.SkuadPSMMakassardalamsebuahlagadiLiga12022/23.Foto:LigaIndonesiaBaru.jpnn.com,MAKASSAR-PSMMakassarakanmenjamuKedahFCpadasemifinalAFCCup2022zonaASEAN.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});PertandinganiniakanberlangsungdiStadionKaptenIWayanDipta,GianyarBali,Selasa(9/8/2022).DuelPSMvsKedahFCdiprediksibakalketatsangsengit.Sebab,keduatimsama-samaberambisimerebutkemenanganagarloloskebabakberikutnya.BacaJuga:PelatihKedahFCTebarAncamankePSMMakassar,Sorot1PemainDalamlagaini,PSMmaupunKedahFCbakalmenurunkanskuadterbaiknya.Kamiakanbekerjaekstrakerasuntukmeraihkemenangan,kataPelatihPSMMakassar,BernardoTavares,Senin(8/8/2022)siang.TimtertuadiIndonesiaitukemungkinanmenurunkanEvertonNascimento,YakobSayuri,danRezkiEkadilinidepan.BacaJuga:SambutHUTke-77RI,PelatihPSMMakassarPunyaPesanPentinguntukSuporterKemudian,PSMbakalmengandalkanWiljanPluim,RasyidBakri,sertaArfanditengah.Sementaraitu,YuranFernandes,ErwinGutawa,YanceSayuri,danAgungMannanakanmenjagabentengpertahananPasukanRamang.Terakhir,RezaAryaPratamabakalmenjadipemainterakhirdibawahmistar.PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.

HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskanrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesar

poker88 penipu-🎖️toto up togel|XOXE88.COM

RezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.

SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.

TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.

MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.

PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.

TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.

PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitralandHotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).

Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.

GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.

ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSajaBekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.

KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahTersangkaMRsaatdiamankandiPolresRejangLebong.Foto:doklinggauposjpnn.com,REJANGLEBONG-JajaranPolresRejangLebongmembongkarkelakuanasliseorangkhatibmasjidberinisialMR(43)diBengkulu.MRyangselamainidikampungnyadikenalsebagaikhatibmasjidternyatapredatoranak.Korbannyaputrinyasendiri.BacaJuga:DiMasjidMRJadiKhatib,SampaidiRumahBerubahMonster,Biadab!BacaJuga:PerbuatanSopirAngkotIniSungguhBikinEmosiTingkatTinggiPriaparuhbayaituternyatatelahmelakukanhalpalingkejiterhadapanaknyasendiriyangmasihberusia9tahun.WargaRejangLebong,Bengkuluitumemerkosaanaknyasendiri,bahkanitusudahdilakukansejak2019lalu.PerbuatankejiterakhiryangdilakukanMRpadaSelasa(9/8)kemarin.BacaJuga:IstrinyaDigoda,MemedBacokAlpian,TempatPijatBanjirDarahAksibejatnyaitudiketahuitetanggasehinggasampaikemejaPolsekBermaniUlu,RejangLebong.KapolresRejangLebongAKBPTonnyKurniawanmenjelaskantersangkaditangkapberdasarakanlaporankorbandidampingitetangga.

Sejumlahpersoneltampaksedangberbaris.Foto:Ricardo/JPNN.jpnn.com,JAKARTA-KepolisianRepublikIndonesia(Polri)memiliki434.135personelyangtersebardiseluruhwilayahnusantara.Setiappolisimemilikipangkatsesuaidenganseleksipendaftarandanberapalamamerekamengabdidikorpsbajucokelat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SistemkepangkataninisudahdiaturdalamPeraturanKapolriNomor3Tahun2016tentangAdministrasiKepangkatanAnggotaKepolisianRepublikIndonesiadalamBabIItentangGolonganKepangkatanPasal3.AdapunjenjangkepangkatanPolriterbagimenjaditiga,pertamaadatamtama,keduabintara,danketigaperwira.BacaJuga:31AnggotaPolisiMelanggarKodeEtikDalamPenangananKasusKematianBrigadirJ,ApakahAdadariKedokteranForensik?TamtamaDimulaidaripangkatterendahadapadajenjangtamtama.1.BhayangkaraDua(Bharada)Iniadalahpangkatterendahdikepolisianketikaseseoranglulusseleksipendaftarantamtamadansudahmenjalanipendidikan.BacaJuga:IniDaftarNama32PolisiBerprestasiPenerimaKenaikanPangkatLuarBiasadariKapolriBentukpangkatbharadainiadalahgarismiringsatu.2.BhayangkaraSatu(Bharatu)ParapemainRealMadridsaatmerayakangelarUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridsuksesmenggondoltrofiUEFASuper2022setelahmenaklukkanEintrachtFrankfurt.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BermaindiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB,ElRealunggul2-0atastimJermantersebut.DuagolkemenanganMadridlahirlewataksiDavidAlaba(37)danKarimBenzema(65).BacaJuga:UEFASuperCup2022:PermalukanFrankfurt,RealMadridRajaEropaRaihanpositifinitakterlepasdaripenampilangemilangsejumlahpenggawaElReal.Darisekianbanyaknama,adasetidaknyalimapemainyangpalingmenonjol.Siapasajamereka?Simakulasannyaberikutini.1.CasemiroGelandangasalBrasilinimenjadipemutusseranganFrankfurtsebelummenembuspertahananElReal.Total,Casemiromampumelakukansembilantekelsukses,duaintersep,dansatublok.BacaJuga:BosPSMMintaPerubahanJadwalPertandinganLiga1,IniPenyebabnyaTakcumaitu,CasemirojugaaktifmembantuseranganElRealdengancatatan54umpanakuratdari64percobaan.Takayal,WhoScoredmemberinyanilai8,6,yangtertinggidibandingpemainMadridlainnya.2.KarimBenzemaLagidanlagi,Benzemamembuktikanbahwadirinyabelumhabis.StrikergaekasalPrancisitumenunjukkankualitasnyasebagaifinisherulung.

Iklan Bawah Artikel